Lineage for d4jbtb_ (4jbt B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005755Species Nocardia farcinica [TaxId:247156] [237265] (4 PDB entries)
  8. 2005761Domain d4jbtb_: 4jbt B: [237273]
    automated match to d1z8qa_
    complexed with asd, fmt, hem, k, mg

Details for d4jbtb_

PDB Entry: 4jbt (more details), 2.2 Å

PDB Description: The 2.2 A crystal structure of CYP154C5 from Nocardia farcinica in complex with androstenedione
PDB Compounds: (B:) cytochrome p450 monooxygenase

SCOPe Domain Sequences for d4jbtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jbtb_ a.104.1.0 (B:) automated matches {Nocardia farcinica [TaxId: 247156]}
cphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkd
inawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptie
ryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsil
tpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqalva
aghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedi
dlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaala
rleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr

SCOPe Domain Coordinates for d4jbtb_:

Click to download the PDB-style file with coordinates for d4jbtb_.
(The format of our PDB-style files is described here.)

Timeline for d4jbtb_: