![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Nocardia farcinica [TaxId:247156] [237265] (5 PDB entries) |
![]() | Domain d4jbtb_: 4jbt B: [237273] automated match to d1z8qa_ complexed with asd, fmt, hem, k, mg |
PDB Entry: 4jbt (more details), 2.2 Å
SCOPe Domain Sequences for d4jbtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jbtb_ a.104.1.0 (B:) automated matches {Nocardia farcinica [TaxId: 247156]} cphsdtltidpmitdlagetsrlraagpltridllgvpalavtghtlarqlltdtrlvkd inawslwqsgtvtrqwpligmidvdrsmftvdgpehrrlrikttqaltrrrldalkptie ryvaellddleragadgavvdlksvfayplpmrvisalmgvpsedqeqlltwykaffsil tpqderlrvidemhgyftemvrrktaepgddltsaliyatdgetplteeevignlqalva aghettvsliltavrallshpeqlrlvrdgeigwetaieetlrwdgpvihllmrfatedi dlgdaviprgegvvmsyraigrditvhgadaddfditrataarhisfghgphicpgaala rleaaialpalftrfphlhpalpldqipnlpvltqndlshfpihlgr
Timeline for d4jbtb_: