SCOPe 2.08: Domain d4jmkb1: 4jmk B:160-303

Lineage for d4jmkb1 (4jmk B:160-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)

8. Domain d4jmkb1: 4jmk B:160-303 [237171]
   Other proteins in same PDB: d4jmkb2
   automated match to d3lj8a_
   complexed with so4

Details for d4jmkb1

PDB Entry: 4jmk, 1.9 Å

PDB Description: structure of dusp8

PDB Compounds: (B:) Dual specificity protein phosphatase 8

SCOPe Domain Sequences for d4jmkb1:

Sequence; same for both SEQRES and ATOM records:

>d4jmkb1 c.45.1.0 (B:160-303) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gltrilphlylgsqkdvlnkdlmtqngisyvlnasnscpkpdficesrfmrvpindnyce
kllpwldksiefidkaklsscqvivhslagisrsatiaiayimktmgmssddayrfvkdr
rpsispnfnflgqlleyerslkll

Timeline for d4jmkb1:

• d4jmkb1 first appeared in SCOPe 2.03, called d4jmkb_
  
• d4jmkb1 appears in SCOPe 2.07