Lineage for d4jmkb1 (4jmk B:160-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875775Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries)
  8. 2875892Domain d4jmkb1: 4jmk B:160-303 [237171]
    Other proteins in same PDB: d4jmkb2
    automated match to d3lj8a_
    complexed with so4

Details for d4jmkb1

PDB Entry: 4jmk (more details), 1.9 Å

PDB Description: structure of dusp8
PDB Compounds: (B:) Dual specificity protein phosphatase 8

SCOPe Domain Sequences for d4jmkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jmkb1 c.45.1.0 (B:160-303) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gltrilphlylgsqkdvlnkdlmtqngisyvlnasnscpkpdficesrfmrvpindnyce
kllpwldksiefidkaklsscqvivhslagisrsatiaiayimktmgmssddayrfvkdr
rpsispnfnflgqlleyerslkll

SCOPe Domain Coordinates for d4jmkb1:

Click to download the PDB-style file with coordinates for d4jmkb1.
(The format of our PDB-style files is described here.)

Timeline for d4jmkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jmkb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jmka_