SCOP 1.69: Domain d1czvb_: 1czv B:

Lineage for d1czvb_ (1czv B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (3 proteins)

6. Protein C2 domain of factor V [49792] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries)

8. Domain d1czvb_: 1czv B: [23717]

Details for d1czvb_

PDB Entry: 1czv, 2.4 Å

PDB Description: crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form

SCOP Domain Sequences for d1czvb_:

Sequence; same for both SEQRES and ATOM records:

>d1czvb_ b.18.1.2 (B:) C2 domain of factor V {Human (Homo sapiens)}
cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei
dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk
ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy

Timeline for d1czvb_:

• d1czvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1czvb_ appears in SCOP 1.67
  
• d1czvb_ appears in SCOP 1.71
  
• d1czvb_ appears in the current release, SCOPe 2.08