Lineage for d1czvb_ (1czv B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) 
Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins) 
Protein C2 domain of factor V [49792] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries) 
Domain d1czvb_: 1czv B: [23717]
Details for d1czvb_
PDB Entry: 1czv (more details), 2.4 Å
PDB Description: crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form
SCOP Domain Sequences for d1czvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czvb_ b.18.1.2 (B:) C2 domain of factor V {Human (Homo sapiens)}
cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei
dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk
ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy
SCOP Domain Coordinates for d1czvb_:
Click to download the PDB-style file with coordinates for d1czvb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1czvb_:
- d1czvb_ appears in SCOP 1.57
- d1czvb_ appears in the current release, SCOPe 2.08
View in 3D
