SCOP 1.57: Domain d1czva_: 1czv A:

Lineage for d1czva_ (1czv A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families)

5. Family b.18.1.2: Coagulation factor C2 domain [49791] (2 proteins)

6. Protein C2 domain of factor V [49792] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries)

8. Domain d1czva_: 1czv A: [23716]

Details for d1czva_

PDB Entry: 1czv, 2.4 Å

PDB Description: crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form

SCOP Domain Sequences for d1czva_:

Sequence; same for both SEQRES and ATOM records:

>d1czva_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens)}
cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei
dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk
ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy

Timeline for d1czva_:

• d1czva_ first appeared (with stable ids) in SCOP 1.55
  
• d1czva_ appears in SCOP 1.59
  
• d1czva_ appears in the current release, SCOPe 2.08