SCOPe 2.08: Domain d1czva_: 1czv A:

Lineage for d1czva_ (1czv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
   automatically mapped to Pfam PF00754

6. Protein C2 domain of factor V [49792] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries)

8. Domain d1czva_: 1czv A: [23716]

Details for d1czva_

PDB Entry: 1czv, 2.4 Å

PDB Description: crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form

PDB Compounds: (A:) protein (coagulation factor v)

SCOPe Domain Sequences for d1czva_:

Sequence; same for both SEQRES and ATOM records:

>d1czva_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]}
cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei
dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk
ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy

Timeline for d1czva_:

• d1czva_ first appeared (with stable ids) in SCOP 1.55
  
• d1czva_ appears in SCOPe 2.07