SCOPe 2.08: Domain d4c2vb_: 4c2v B:

Lineage for d4c2vb_ (4c2v B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries)

8. Domain d4c2vb_: 4c2v B: [237117]
   Other proteins in same PDB: d4c2va_
   automated match to d3h10a_
   complexed with yja

Details for d4c2vb_

PDB Entry: 4c2v, 1.49 Å

PDB Description: Aurora B kinase in complex with the specific inhibitor Barasertib

PDB Compounds: (B:) aurora kinase b-a

SCOPe Domain Sequences for d4c2vb_:

Sequence; same for both SEQRES and ATOM records:

>d4c2vb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegve
hqlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsat
fmeeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldy
lppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdg
skdliskllryhppqrlplkgvmehpwvkansrrvlppvyq

Timeline for d4c2vb_:

• d4c2vb_ first appeared in SCOPe 2.03
  
• d4c2vb_ appears in SCOPe 2.07