Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (11 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (8 PDB entries) |
Domain d4c2vb_: 4c2v B: [237117] Other proteins in same PDB: d4c2va_ automated match to d3h10a_ complexed with yja |
PDB Entry: 4c2v (more details), 1.49 Å
SCOPe Domain Sequences for d4c2vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2vb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} qntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegve hqlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsat fmeeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldy lppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdg skdliskllryhppqrlplkgvmehpwvkansrrvlppvyq
Timeline for d4c2vb_: