Lineage for d4c2vb_ (4c2v B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435613Protein automated matches [190091] (11 species)
    not a true protein
  7. 1435614Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (8 PDB entries)
  8. 1435615Domain d4c2vb_: 4c2v B: [237117]
    Other proteins in same PDB: d4c2va_
    automated match to d3h10a_
    complexed with yja

Details for d4c2vb_

PDB Entry: 4c2v (more details), 1.49 Å

PDB Description: Aurora B kinase in complex with the specific inhibitor Barasertib
PDB Compounds: (B:) aurora kinase b-a

SCOPe Domain Sequences for d4c2vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2vb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
qntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegve
hqlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsat
fmeeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldy
lppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdg
skdliskllryhppqrlplkgvmehpwvkansrrvlppvyq

SCOPe Domain Coordinates for d4c2vb_:

Click to download the PDB-style file with coordinates for d4c2vb_.
(The format of our PDB-style files is described here.)

Timeline for d4c2vb_: