Lineage for d4m75i_ (4m75 I:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312761Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1312762Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1313271Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1313272Protein automated matches [190914] (7 species)
    not a true protein
  7. 1313302Species Saccharomyces cerevisiae [TaxId:559292] [228531] (2 PDB entries)
  8. 1313311Domain d4m75i_: 4m75 I: [237059]
    automated match to d4m75b_
    protein/RNA complex; complexed with cl

Details for d4m75i_

PDB Entry: 4m75 (more details), 2.95 Å

PDB Description: Crystal structure of Lsm1-7 complex
PDB Compounds: (I:) u6 snrna-associated sm-like protein lsm2

SCOPe Domain Sequences for d4m75i_:

Sequence, based on SEQRES records: (download)

>d4m75i_ b.38.1.0 (I:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
firgstvryvylnknmvdtnllqdatrr

Sequence, based on observed residues (ATOM records): (download)

>d4m75i_ b.38.1.0 (I:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdkyphlgsvrnifi
rgstvryvylnknmvdtnllqdatrr

SCOPe Domain Coordinates for d4m75i_:

Click to download the PDB-style file with coordinates for d4m75i_.
(The format of our PDB-style files is described here.)

Timeline for d4m75i_: