| Class b: All beta proteins [48724] (174 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
| Protein automated matches [190914] (7 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:559292] [228531] (2 PDB entries) |
| Domain d4m75i_: 4m75 I: [237059] automated match to d4m75b_ protein/RNA complex; complexed with cl |
PDB Entry: 4m75 (more details), 2.95 Å
SCOPe Domain Sequences for d4m75i_:
Sequence, based on SEQRES records: (download)
>d4m75i_ b.38.1.0 (I:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni
firgstvryvylnknmvdtnllqdatrr
>d4m75i_ b.38.1.0 (I:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdkyphlgsvrnifi
rgstvryvylnknmvdtnllqdatrr
Timeline for d4m75i_: