SCOPe 2.07: Domain d4l85c1: 4l85 C:3-118

Lineage for d4l85c1 (4l85 C:3-118)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (10 PDB entries)

8. Domain d4l85c1: 4l85 C:3-118 [237054]
   Other proteins in same PDB: d4l85a2, d4l85b2, d4l85c2
   automated match to d1zh4a_
   complexed with iod; mutant

Details for d4l85c1

PDB Entry: 4l85, 2.2 Å

PDB Description: Crystal structure of receiver domain of KdpE D52A mutant from E. coli

PDB Compounds: (C:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d4l85c1:

Sequence; same for both SEQRES and ATOM records:

>d4l85c1 c.23.1.0 (C:3-118) automated matches {Escherichia coli [TaxId: 562]}
nvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdgdgie
firdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrr

Timeline for d4l85c1:

• d4l85c1 first appeared in SCOPe 2.03, called d4l85c_
  
• d4l85c1 appears in SCOPe 2.06
  
• d4l85c1 appears in the current release, SCOPe 2.08