SCOPe 2.08: Domain d4l85b1: 4l85 B:3-119

Lineage for d4l85b1 (4l85 B:3-119)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225766] (2 PDB entries)

8. Domain d4l85b1: 4l85 B:3-119 [237053]
   Other proteins in same PDB: d4l85a2, d4l85b2, d4l85c2
   automated match to d1zh4a_
   complexed with iod; mutant

Details for d4l85b1

PDB Entry: 4l85, 2.2 Å

PDB Description: Crystal structure of receiver domain of KdpE D52A mutant from E. coli

PDB Compounds: (B:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d4l85b1:

Sequence, based on SEQRES records:

>d4l85b1 c.23.1.0 (B:3-119) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdgdgie
firdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh

Sequence, based on observed residues (ATOM records):

>d4l85b1 c.23.1.0 (B:3-119) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nvlivedrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdgdgiefirdl
rqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh

Timeline for d4l85b1:

• d4l85b1 first appeared in SCOPe 2.03, called d4l85b_
  
• d4l85b1 appears in SCOPe 2.07