![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [225766] (2 PDB entries) |
![]() | Domain d4l85b1: 4l85 B:3-119 [237053] Other proteins in same PDB: d4l85a2, d4l85b2, d4l85c2 automated match to d1zh4a_ complexed with iod; mutant |
PDB Entry: 4l85 (more details), 2.2 Å
SCOPe Domain Sequences for d4l85b1:
Sequence, based on SEQRES records: (download)
>d4l85b1 c.23.1.0 (B:3-119) automated matches {Escherichia coli K-12 [TaxId: 83333]} nvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdgdgie firdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh
>d4l85b1 c.23.1.0 (B:3-119) automated matches {Escherichia coli K-12 [TaxId: 83333]} nvlivedrflrtalegdgmrvfeaetlqrglleaatrkpdliilalglpdgdgiefirdl rqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrh
Timeline for d4l85b1:
![]() Domains from other chains: (mouse over for more information) d4l85a1, d4l85a2, d4l85c1, d4l85c2 |