Lineage for d4j5dx_ (4j5d X:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553467Protein Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F [141511] (1 species)
  7. 1553468Species Human (Homo sapiens) [TaxId:9606] [141512] (27 PDB entries)
    Uniprot P30405 44-207
  8. 1553484Domain d4j5dx_: 4j5d X: [237025]
    automated match to d3qyua_
    complexed with 728

Details for d4j5dx_

PDB Entry: 4j5d (more details), 1.32 Å

PDB Description: human cyclophilin d complexed with an inhibitor
PDB Compounds: (X:) Peptidyl-prolyl cis-trans isomerase F, mitochondrial

SCOPe Domain Sequences for d4j5dx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j5dx_ b.62.1.1 (X:) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]}
gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls

SCOPe Domain Coordinates for d4j5dx_:

Click to download the PDB-style file with coordinates for d4j5dx_.
(The format of our PDB-style files is described here.)

Timeline for d4j5dx_: