Lineage for d4cq1e1 (4cq1 E:337-444)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415602Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1415603Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1416033Protein automated matches [190332] (2 species)
    not a true protein
  7. 1416034Species Human (Homo sapiens) [TaxId:9606] [187155] (13 PDB entries)
  8. 1416043Domain d4cq1e1: 4cq1 E:337-444 [236984]
    Other proteins in same PDB: d4cq1a2, d4cq1b2, d4cq1c2, d4cq1d2, d4cq1e2, d4cq1f2, d4cq1g2, d4cq1h2
    automated match to d4ckob1
    complexed with cl, zn

Details for d4cq1e1

PDB Entry: 4cq1 (more details), 1.69 Å

PDB Description: crystal structure of the neuronal isoform of ptb
PDB Compounds: (E:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d4cq1e1:

Sequence, based on SEQRES records: (download)

>d4cq1e1 d.58.7.1 (E:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlpreglddqgltkdfgnsplhrfkkpgs

Sequence, based on observed residues (ATOM records): (download)

>d4cq1e1 d.58.7.1 (E:337-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntvllvsnlneemvtpqslftlfgvygdvqrvkilynkkdsaliqmadgnqsqlamnhln
gqkmygkiirvtlskhqtvqlprgltkdfgnsplhrfkkpgs

SCOPe Domain Coordinates for d4cq1e1:

Click to download the PDB-style file with coordinates for d4cq1e1.
(The format of our PDB-style files is described here.)

Timeline for d4cq1e1: