SCOPe 2.07: Domain d4o0xa1: 4o0x A:300-589

Lineage for d4o0xa1 (4o0x A:300-589)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)

8. Domain d4o0xa1: 4o0x A:300-589 [236939]
   Other proteins in same PDB: d4o0xa2
   automated match to d2c30a_
   complexed with 2oq

Details for d4o0xa1

PDB Entry: 4o0x, 2.48 Å

PDB Description: Back pocket flexibility provides group-II PAK selectivity for type 1 kinase inhibitors

PDB Compounds: (A:) serine/threonine-protein kinase pak 4

SCOPe Domain Sequences for d4o0xa1:

Sequence; same for both SEQRES and ATOM records:

>d4o0xa1 d.144.1.0 (A:300-589) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr

Timeline for d4o0xa1:

• d4o0xa1 first appeared in SCOPe 2.03, called d4o0xa_
  
• d4o0xa1 appears in SCOPe 2.06
  
• d4o0xa1 appears in the current release, SCOPe 2.08