SCOPe 2.06: Domain d4ncga2: 4ncg A:430-556

Lineage for d4ncga2 (4ncg A:430-556)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d4ncga2: 4ncg A:430-556 [236816]
   Other proteins in same PDB: d4ncga1, d4ncgb_
   automated match to d2rf2a3
   complexed with 2kw; mutant

Details for d4ncga2

PDB Entry: 4ncg, 2.58 Å

PDB Description: discovery of doravirine, an orally bioavailable non-nucleoside reverse transcriptase inhibitor potent against a wide range of resistant mutant hiv viruses

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d4ncga2:

Sequence; same for both SEQRES and ATOM records:

>d4ncga2 c.55.3.0 (A:430-556) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

Timeline for d4ncga2:

• d4ncga2 first appeared in SCOPe 2.03
  
• d4ncga2 appears in SCOPe 2.05
  
• d4ncga2 appears in SCOPe 2.07
  
• d4ncga2 appears in the current release, SCOPe 2.08