SCOPe 2.07: Domain d4luda3: 4lud A:250-531

Lineage for d4luda3 (4lud A:250-531)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)

8. Domain d4luda3: 4lud A:250-531 [236789]
   Other proteins in same PDB: d4luda1, d4luda2, d4luda4, d4ludb1, d4ludb2, d4ludb4
   automated match to d1qcfa3
   complexed with ca, cl, gol, sk8

Details for d4luda3

PDB Entry: 4lud, 2.85 Å

PDB Description: crystal structure of hck in complex with the fluorescent compound skf86002

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d4luda3:

Sequence, based on SEQRES records:

>d4luda3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records):

>d4luda3 d.144.1.7 (A:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpsveaflaean
vmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiae
gmafieqrnyihrdlraanilvsaslvckiadfglarvipikwtapeainfgsftiksdv
wsfgillmeivtygripypgmsnpelergyrmprpencpeelynimmrcwknrpeerptf
eyiqsvlddfytatesqyeeip

Timeline for d4luda3:

• d4luda3 first appeared in SCOPe 2.03
  
• d4luda3 appears in SCOPe 2.06
  
• d4luda3 appears in the current release, SCOPe 2.08