SCOPe 2.04: Domain d4codd_: 4cod D:

Lineage for d4codd_ (4cod D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (50 PDB entries)

8. Domain d4codd_: 4cod D: [236704]
   automated match to d1p44a_
   complexed with kv1, nad

Details for d4codd_

PDB Entry: 4cod, 2.4 Å

PDB Description: Encoded library technology as a source of hits for the discovery and lead optimization of a potent and selective class of bactericidal direct inhibitors of Mycobacterium tuberculosis InhA

PDB Compounds: (D:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4codd_:

Sequence; same for both SEQRES and ATOM records:

>d4codd_ c.2.1.2 (D:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

Timeline for d4codd_:

• d4codd_ first appeared in SCOPe 2.03
  
• d4codd_ appears in SCOPe 2.05
  
• d4codd_ appears in the current release, SCOPe 2.08