SCOPe 2.04: Domain d4c3mc_: 4c3m C:

Lineage for d4c3mc_ (4c3m C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein PII (product of glnB) [54915] (7 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId:1131] [102970] (4 PDB entries)

8. Domain d4c3mc_: 4c3m C: [236689]
   automated match to d2v5hg_

Details for d4c3mc_

PDB Entry: 4c3m, 2.15 Å

PDB Description: Structure of wildtype PII from S. elongatus at medium resolution

PDB Compounds: (C:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d4c3mc_:

Sequence, based on SEQRES records:

>d4c3mc_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekn

Sequence, based on observed residues (ATOM records):

>d4c3mc_ d.58.5.1 (C:) PII (product of glnB) {Cyanobacteria (Synechococcus sp.) pcc 7942 [TaxId: 1131]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfflqklkleivvedaqvdtvidkiv
aaartgeigdgkifvspvdqtirirtgekn

Timeline for d4c3mc_:

• d4c3mc_ first appeared in SCOPe 2.03
  
• d4c3mc_ appears in SCOPe 2.05
  
• d4c3mc_ appears in the current release, SCOPe 2.08