SCOPe 2.03: Domain d3zlhb2: 3zlh B:140-433

Lineage for d3zlhb2 (3zlh B:140-433)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:286636] [236667] (3 PDB entries)

8. Domain d3zlhb2: 3zlh B:140-433 [236678]
   Other proteins in same PDB: d3zlha1, d3zlhb1
   automated match to d1onea1

Details for d3zlhb2

PDB Entry: 3zlh, 2.9 Å

PDB Description: structure of group a streptococcal enolase

PDB Compounds: (B:) enolase

SCOPe Domain Sequences for d3zlhb2:

Sequence; same for both SEQRES and ATOM records:

>d3zlhb2 c.1.11.0 (B:140-433) automated matches {Streptococcus pyogenes [TaxId: 286636]}
kvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwgaevfhalkkilkerglv
tavgdeggfapkfegtedgvetilkaieaagyeagengimigfdcassefydkerkvydy
tkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgwkvlterlgkrvqlvgd
dffvtnteylargikenaansilikvnqigtltetfeaiemakeagytavvshrsgeted
stiadiavatnagqiktgslsrtdriakynqllriedqlgevaqykgiksfynl

Timeline for d3zlhb2:

• d3zlhb2 is new in SCOPe 2.03-stable
  
• d3zlhb2 appears in SCOPe 2.04
  
• d3zlhb2 appears in the current release, SCOPe 2.08