Lineage for d3zlha1 (3zlh A:0-139)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413282Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)
  8. 1413288Domain d3zlha1: 3zlh A:0-139 [236679]
    Other proteins in same PDB: d3zlha2, d3zlhb2
    automated match to d1p43a2

Details for d3zlha1

PDB Entry: 3zlh (more details), 2.9 Å

PDB Description: structure of group a streptococcal enolase
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d3zlha1:

Sequence, based on SEQRES records: (download)

>d3zlha1 d.54.1.0 (A:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry
lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava
raaadylevplytylggfnt

Sequence, based on observed residues (ATOM records): (download)

>d3zlha1 d.54.1.0 (A:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgeheavelrdgdksrylglg
tqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaa
dylevplytylggfnt

SCOPe Domain Coordinates for d3zlha1:

Click to download the PDB-style file with coordinates for d3zlha1.
(The format of our PDB-style files is described here.)

Timeline for d3zlha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zlha2