Lineage for d3zlfc1 (3zlf C:0-139)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413282Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)
  8. 1413287Domain d3zlfc1: 3zlf C:0-139 [236669]
    Other proteins in same PDB: d3zlfa2, d3zlfb2, d3zlfc2
    automated match to d1p43a2
    complexed with po4; mutant

Details for d3zlfc1

PDB Entry: 3zlf (more details), 2.15 Å

PDB Description: structure of group a streptococcal enolase k312a mutant
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d3zlfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zlfc1 d.54.1.0 (C:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry
lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava
raaadylevplytylggfnt

SCOPe Domain Coordinates for d3zlfc1:

Click to download the PDB-style file with coordinates for d3zlfc1.
(The format of our PDB-style files is described here.)

Timeline for d3zlfc1: