SCOPe 2.03: Domain d3zlfc1: 3zlf C:0-139

Lineage for d3zlfc1 (3zlf C:0-139)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:286636] [236665] (3 PDB entries)

8. Domain d3zlfc1: 3zlf C:0-139 [236669]
   Other proteins in same PDB: d3zlfa2, d3zlfb2, d3zlfc2
   automated match to d1p43a2
   complexed with po4; mutant

Details for d3zlfc1

PDB Entry: 3zlf, 2.15 Å

PDB Description: structure of group a streptococcal enolase k312a mutant

PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d3zlfc1:

Sequence; same for both SEQRES and ATOM records:

>d3zlfc1 d.54.1.0 (C:0-139) automated matches {Streptococcus pyogenes [TaxId: 286636]}
hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeheavelrdgdksry
lglgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiava
raaadylevplytylggfnt

Timeline for d3zlfc1:

• d3zlfc1 is new in SCOPe 2.03-stable
  
• d3zlfc1 appears in SCOPe 2.04
  
• d3zlfc1 appears in the current release, SCOPe 2.08