Lineage for d1p43a2 (1p43 A:1-141)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412715Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1412760Protein Enolase [54828] (9 species)
  7. 1412761Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (16 PDB entries)
  8. 1412764Domain d1p43a2: 1p43 A:1-141 [94073]
    Other proteins in same PDB: d1p43a1, d1p43b1
    complexed with 2pg, mg

Details for d1p43a2

PDB Entry: 1p43 (more details), 1.8 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase
PDB Compounds: (A:) enolase 1

SCOPe Domain Sequences for d1p43a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p43a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOPe Domain Coordinates for d1p43a2:

Click to download the PDB-style file with coordinates for d1p43a2.
(The format of our PDB-style files is described here.)

Timeline for d1p43a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p43a1