Lineage for d4ls4a_ (4ls4 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688581Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1688582Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1688598Family d.298.1.2: RelE-like [143015] (3 proteins)
    Pfam PF05016
  6. 1688605Protein automated matches [190809] (2 species)
    not a true protein
  7. 1688606Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries)
  8. 1688608Domain d4ls4a_: 4ls4 A: [236602]
    automated match to d1z8ma1
    complexed with br; mutant

Details for d4ls4a_

PDB Entry: 4ls4 (more details), 1.66 Å

PDB Description: Crystal structure of L66S mutant toxin from Helicobacter pylori
PDB Compounds: (A:) Uncharacterized protein, Toxin

SCOPe Domain Sequences for d4ls4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ls4a_ d.298.1.2 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
shmlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfre
chikpdvslvylvkddelillrlgshself

SCOPe Domain Coordinates for d4ls4a_:

Click to download the PDB-style file with coordinates for d4ls4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ls4a_: