|  | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) | 
|  | Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 | 
|  | Superfamily d.298.1: RelE-like [143011] (3 families)  Toxin component of plasmid stabilisation system | 
|  | Family d.298.1.2: RelE-like [143015] (3 proteins) Pfam PF05016 | 
|  | Protein automated matches [190809] (2 species) not a true protein | 
|  | Species Helicobacter pylori [TaxId:85962] [236600] (3 PDB entries) | 
|  | Domain d4lsyb_: 4lsy B: [236601] automated match to d1z8ma1 complexed with cu, flc; mutant | 
PDB Entry: 4lsy (more details), 1.9 Å
SCOPe Domain Sequences for d4lsyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lsyb_ d.298.1.2 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mlklnlkksfqkdfdklllngfddsvlneviltlrkkepldpqfqdhalkgkwkpfrech
ikpdvslvylvkddelillrlgshself
Timeline for d4lsyb_: