![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.1: PHM/PNGase F [49742] (2 families) ![]() members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
![]() | Family b.121.1.1: Glycosyl-asparaginase [49743] (2 proteins) |
![]() | Protein Peptide:N-glycosidase F, PNGase F [49744] (1 species) |
![]() | Species Flavobacterium meningosepticum [TaxId:238] [49745] (3 PDB entries) |
![]() | Domain d1pnga1: 1png A:5-140 [23657] |
PDB Entry: 1png (more details), 2.2 Å
SCOPe Domain Sequences for d1pnga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnga1 b.121.1.1 (A:5-140) Peptide:N-glycosidase F, PNGase F {Flavobacterium meningosepticum [TaxId: 238]} ntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewdryan vyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetwlakg reysvdfdivygtpdy
Timeline for d1pnga1: