PDB entry 1png

View 1png on RCSB PDB site
Description: crystal structure of peptide-n(4)-(n-acetyl-beta-d-glucosaminyl) asparagine amidase at 2.2 angstroms resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-06-02, released 1994-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide-n(4)-(n-acetyl-beta-d-glucosaminyl)asparagine amidase f
    Species: Elizabethkingia meningoseptica [TaxId:238]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pnga1, d1pnga2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pngA (A:)
    apadntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewd
    ryanvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetw
    lakgreysvdfdivygtpdykysavvpviqynkssidgvpygkahtlglkkniqlptnte
    kaylrttisgwghakpydagsrgcaewcfrthtiainnantfqhqlgalgcsanpinnqs
    pgnwapdragwcpgmavptridvlnnsltgstfsyeykfqswtnngtngdafyaissfvi
    aksntpisapvvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pngA (A:)
    ntvniktfdkvknafgdglsqsaegtftfpadvttvktikmfiknecpnktcdewdryan
    vyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetwlakg
    reysvdfdivygtpdykysavvpviqynkssidgvpygkahtlglkkniqlptntekayl
    rttisgwghakpydagsrgcaewcfrthtiainnantfqhqlgalgcsanpinnqspgnw
    apdragwcpgmavptridvlnnsltgstfsyeykfqswtnngtngdafyaissfviaksn
    tpisapvvtn