Lineage for d4cl3a1 (4cl3 A:1-143)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105845Protein Malate dehydrogenase [51849] (13 species)
  7. 2105882Species Chloroflexus sp. [TaxId:480224] [236527] (1 PDB entry)
  8. 2105883Domain d4cl3a1: 4cl3 A:1-143 [236530]
    Other proteins in same PDB: d4cl3a2, d4cl3d2
    automated match to d1guya1
    complexed with act, cd, cl, peg

Details for d4cl3a1

PDB Entry: 4cl3 (more details), 1.7 Å

PDB Description: 1.70 a resolution structure of the malate dehydrogenase from chloroflexus aurantiacus
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4cl3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cl3a1 c.2.1.5 (A:1-143) Malate dehydrogenase {Chloroflexus sp. [TaxId: 480224]}
mrkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvt
gtnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnn
pldamtylaaevsgfpkervigq

SCOPe Domain Coordinates for d4cl3a1:

Click to download the PDB-style file with coordinates for d4cl3a1.
(The format of our PDB-style files is described here.)

Timeline for d4cl3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cl3a2