SCOPe 2.03: Domain d4oaea_: 4oae A:

Lineage for d4oaea_ (4oae A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Putative acetyltransferase PA4794 [143700] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [143701] (19 PDB entries)
   Uniprot Q9HV14 1-160

8. Domain d4oaea_: 4oae A: [236482]
   automated match to d4kuaa_
   complexed with clm, edo, so4; mutant

Details for d4oaea_

PDB Entry: 4oae, 1.25 Å

PDB Description: crystal structure of a gnat superfamily acetyltransferase pa4794 c29a/c117a/y128a mutant in complex with chloramphenicol

PDB Compounds: (A:) GNAT superfamily acetyltransferase PA4794

SCOPe Domain Sequences for d4oaea_:

Sequence; same for both SEQRES and ATOM records:

>d4oaea_ d.108.1.1 (A:) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
hmqlshrpaetgdletvagfpqdrdelfyaypkaiwpfsvaqlaaaiaerrgstvavhdg
qvlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkisafn
anaaglllatqlgyqpraiaerhdpdgrrvaliqmdkple

Timeline for d4oaea_:

• d4oaea_ is new in SCOPe 2.03-stable
  
• d4oaea_ appears in SCOPe 2.04
  
• d4oaea_ appears in the current release, SCOPe 2.08, called d4oaea1