![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Putative acetyltransferase PA4794 [143700] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143701] (22 PDB entries) Uniprot Q9HV14 1-160 |
![]() | Domain d4oaea1: 4oae A:1-159 [236482] Other proteins in same PDB: d4oaea2 automated match to d4kuaa_ complexed with clm, edo, so4; mutant |
PDB Entry: 4oae (more details), 1.25 Å
SCOPe Domain Sequences for d4oaea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oaea1 d.108.1.1 (A:1-159) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} mqlshrpaetgdletvagfpqdrdelfyaypkaiwpfsvaqlaaaiaerrgstvavhdgq vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkisafna naaglllatqlgyqpraiaerhdpdgrrvaliqmdkple
Timeline for d4oaea1: