Lineage for d4neef_ (4nee F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577424Superfamily d.110.4: SNARE-like [64356] (5 families) (S)
    beta(2)-alpha-beta(3)-alpha(2)
  5. 2577437Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins)
    automatically mapped to Pfam PF01217
  6. 2577441Protein Sigma2 adaptin (clathrin coat assembly protein AP17) [75524] (1 species)
  7. 2577442Species Mouse (Mus musculus) [TaxId:10090] [75525] (7 PDB entries)
  8. 2577450Domain d4neef_: 4nee F: [236472]
    Other proteins in same PDB: d4neec1, d4neec2, d4neee1, d4neee2, d4neeh1, d4neeh2, d4neek1, d4neek2
    automated match to d2vgls_

Details for d4neef_

PDB Entry: 4nee (more details), 2.88 Å

PDB Description: crystal structure of AP-2 alpha/simga2 complex bound to HIV-1 Nef
PDB Compounds: (F:) ap-2 complex subunit sigma

SCOPe Domain Sequences for d4neef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4neef_ d.110.4.2 (F:) Sigma2 adaptin (clathrin coat assembly protein AP17) {Mouse (Mus musculus) [TaxId: 10090]}
mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
geiretsqtkvlkqllmlqsle

SCOPe Domain Coordinates for d4neef_:

Click to download the PDB-style file with coordinates for d4neef_.
(The format of our PDB-style files is described here.)

Timeline for d4neef_: