SCOPe 2.06: Domain d4l2oa_: 4l2o A:

Lineage for d4l2oa_ (4l2o A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.1: ALDH-like [53721] (6 proteins)

6. Protein automated matches [190401] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189906] (18 PDB entries)

8. Domain d4l2oa_: 4l2o A: [236436]
   automated match to d3szba_
   complexed with 1dd, act, k, nad

Details for d4l2oa_

PDB Entry: 4l2o, 1.94 Å

PDB Description: crystal structure of human aldh3a1 with its selective inhibitor 1-(4- fluorophenyl)sulfonyl-2-methylbenzimidazole

PDB Compounds: (A:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4l2oa_:

Sequence; same for both SEQRES and ATOM records:

>d4l2oa_ c.82.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skiseavkraraafssgrtrplqfriqqlealqrliqeqeqelvgalaadlhknewnayy
eevvyvleeieymiqklpewaadepvektpqtqqdelyihseplgvvlvigtwnypfnlt
iqpmvgaiaagnavvlkpselsenmasllatiipqyldkdlypvinggvpettellkerf
dhilytgstgvgkiimtaaakhltpvtlelggkspcyvdkncdldvacrriawgkfmnsg
qtcvapdyilcdpsiqnqiveklkkslkefygedakksrdygriisarhfqrvmgliegq
kvayggtgdaatryiaptiltdvdpqspvmqeeifgpvlpivcvrsleeaiqfinqrekp
lalymfssndkvikkmiaetssggvaandvivhitlhslpfggvgnsgmgsyhgkksfet
fshrrsclvrplmndeglkvryppsp

Timeline for d4l2oa_:

• d4l2oa_ first appeared in SCOPe 2.03
  
• d4l2oa_ appears in SCOPe 2.05
  
• d4l2oa_ appears in SCOPe 2.07
  
• d4l2oa_ appears in the current release, SCOPe 2.08