Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189906] (18 PDB entries) |
Domain d4l2oa_: 4l2o A: [236436] automated match to d3szba_ complexed with 1dd, act, k, nad |
PDB Entry: 4l2o (more details), 1.94 Å
SCOPe Domain Sequences for d4l2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2oa_ c.82.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skiseavkraraafssgrtrplqfriqqlealqrliqeqeqelvgalaadlhknewnayy eevvyvleeieymiqklpewaadepvektpqtqqdelyihseplgvvlvigtwnypfnlt iqpmvgaiaagnavvlkpselsenmasllatiipqyldkdlypvinggvpettellkerf dhilytgstgvgkiimtaaakhltpvtlelggkspcyvdkncdldvacrriawgkfmnsg qtcvapdyilcdpsiqnqiveklkkslkefygedakksrdygriisarhfqrvmgliegq kvayggtgdaatryiaptiltdvdpqspvmqeeifgpvlpivcvrsleeaiqfinqrekp lalymfssndkvikkmiaetssggvaandvivhitlhslpfggvgnsgmgsyhgkksfet fshrrsclvrplmndeglkvryppsp
Timeline for d4l2oa_: