Lineage for d4iufa_ (4iuf A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195570Domain d4iufa_: 4iuf A: [236408]
    automated match to d1uawa_
    protein/DNA complex; protein/RNA complex

Details for d4iufa_

PDB Entry: 4iuf (more details), 2.75 Å

PDB Description: Crystal Structure of Human TDP-43 RRM1 Domain in Complex with a Single-stranded DNA
PDB Compounds: (A:) TAR DNA-binding protein 43

SCOPe Domain Sequences for d4iufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iufa_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsdlivlglpwktteqdlkeyfstfgevlmvqvkkdlktghskgfgfvrfteyetqvkvm
sqrhmidgrwcdcklpn

SCOPe Domain Coordinates for d4iufa_:

Click to download the PDB-style file with coordinates for d4iufa_.
(The format of our PDB-style files is described here.)

Timeline for d4iufa_: