Lineage for d1f53a_ (1f53 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941691Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 941692Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 941790Family b.11.1.4: Killer toxin-like protein SKLP [49716] (1 protein)
  6. 941791Protein Killer toxin-like protein SKLP [49717] (1 species)
  7. 941792Species Streptomyces sp. [TaxId:1931] [49718] (1 PDB entry)
  8. 941793Domain d1f53a_: 1f53 A: [23632]

Details for d1f53a_

PDB Entry: 1f53 (more details)

PDB Description: nmr structure of killer toxin-like protein sklp
PDB Compounds: (A:) yeast killer toxin-like protein

SCOPe Domain Sequences for d1f53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f53a_ b.11.1.4 (A:) Killer toxin-like protein SKLP {Streptomyces sp. [TaxId: 1931]}
idhvpcrggenflkiwshsggqqsvdcyanrgridfggwwvdkistgnndliyydangds
vrvdrwhditypnrppkvnsieil

SCOPe Domain Coordinates for d1f53a_:

Click to download the PDB-style file with coordinates for d1f53a_.
(The format of our PDB-style files is described here.)

Timeline for d1f53a_: