Lineage for d1ag4__ (1ag4 -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458617Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 458618Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) (S)
  5. 458619Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)
  6. 458689Protein Spherulin 3a (S3a) [49708] (1 species)
  7. 458690Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries)
  8. 458693Domain d1ag4__: 1ag4 - [23629]

Details for d1ag4__

PDB Entry: 1ag4 (more details)

PDB Description: nmr structure of spherulin 3a (s3a) from physarum polycephalum, minimized average structure

SCOP Domain Sequences for d1ag4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag4__ b.11.1.1 (-) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum)}
msvckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkaf
ifkddrfngnfirleessqvtdlttrnlndaissiivatfesa

SCOP Domain Coordinates for d1ag4__:

Click to download the PDB-style file with coordinates for d1ag4__.
(The format of our PDB-style files is described here.)

Timeline for d1ag4__: