Lineage for d1ag4a_ (1ag4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773574Protein Spherulin 3a (S3a) [49708] (1 species)
  7. 2773575Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries)
  8. 2773578Domain d1ag4a_: 1ag4 A: [23629]

Details for d1ag4a_

PDB Entry: 1ag4 (more details)

PDB Description: nmr structure of spherulin 3a (s3a) from physarum polycephalum, minimized average structure
PDB Compounds: (A:) spherulin 3a

SCOPe Domain Sequences for d1ag4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ag4a_ b.11.1.1 (A:) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum) [TaxId: 5791]}
msvckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkaf
ifkddrfngnfirleessqvtdlttrnlndaissiivatfesa

SCOPe Domain Coordinates for d1ag4a_:

Click to download the PDB-style file with coordinates for d1ag4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ag4a_: