PDB entry 1ag4

View 1ag4 on RCSB PDB site
Description: nmr structure of spherulin 3a (s3a) from physarum polycephalum, minimized average structure
Class: structural protein
Keywords: structural protein, spherulation-specific protein,
Deposited on 1997-04-01, released 1998-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spherulin 3a
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ag4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ag4A (A:)
    msvckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkaf
    ifkddrfngnfirleessqvtdlttrnlndaissiivatfesa