Lineage for d1ag4__ (1ag4 -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families) 
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins) 
Protein Spherulin 3a (S3a) [49708] (1 species) Species Slime mold (Physarum polycephalum) [TaxId:5791] [49709] (2 PDB entries) 
Domain d1ag4__: 1ag4 - [23629]
Details for d1ag4__
PDB Entry: 1ag4 (more details)
PDB Description: nmr structure of spherulin 3a (s3a) from physarum polycephalum, minimized average structure
SCOP Domain Sequences for d1ag4__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ag4__ b.11.1.1 (-) Spherulin 3a (S3a) {Slime mold (Physarum polycephalum)}
msvckgvsgnpakgevflykhvnfqgdswkvtgnvydfrsvsglndvvssvkvgpntkaf
ifkddrfngnfirleessqvtdlttrnlndaissiivatfesa
SCOP Domain Coordinates for d1ag4__:
Click to download the PDB-style file with coordinates for d1ag4__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ag4__:
- d1ag4__ first appeared (with stable ids) in SCOP 1.55
- d1ag4__ appears in SCOP 1.59
- d1ag4__ appears in the current release, SCOPe 2.08, called d1ag4a_
View in 3D