Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein automated matches [190260] (25 species) not a true protein |
Species Human poliovirus 1 [TaxId:12081] [193135] (16 PDB entries) |
Domain d4nlxa_: 4nlx A: [236249] automated match to d3ddka_ complexed with 1pe, acy, na; mutant |
PDB Entry: 4nlx (more details), 2.6 Å
SCOPe Domain Sequences for d4nlxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nlxa_ e.8.1.4 (A:) automated matches {Human poliovirus 1 [TaxId: 12081]} geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsavsgtsifnsmi nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll awhngeeeynkflakirsvpigraldlpeystlydrwldsf
Timeline for d4nlxa_: