Lineage for d4nlpa_ (4nlp A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017732Protein automated matches [190260] (25 species)
    not a true protein
  7. 3017976Species Human poliovirus 1 [TaxId:12081] [193135] (16 PDB entries)
  8. 3017983Domain d4nlpa_: 4nlp A: [236235]
    automated match to d3ddka_
    complexed with 1pe, acy, na; mutant

Details for d4nlpa_

PDB Entry: 4nlp (more details), 2.2 Å

PDB Description: Poliovirus Polymerase - C290V Loop Mutant
PDB Compounds: (A:) RNA-directed RNA polymerase 3D-POL

SCOPe Domain Sequences for d4nlpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nlpa_ e.8.1.4 (A:) automated matches {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgvsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOPe Domain Coordinates for d4nlpa_:

Click to download the PDB-style file with coordinates for d4nlpa_.
(The format of our PDB-style files is described here.)

Timeline for d4nlpa_: