Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (19 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [193276] (6 PDB entries) |
Domain d4mvnd_: 4mvn D: [236219] automated match to d3ufab_ complexed with i1s |
PDB Entry: 4mvn (more details), 1.7 Å
SCOPe Domain Sequences for d4mvnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mvnd_ b.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]} eknvkeitdatkepynsvvafvggtgvvvgkntivtnkhiaksndifknrvsahhsskgk gggnydvkdiveypgkedlaivhvhetsteglnfnknvsytkfadgakvkdrisvigypk gaqtkykmfestgtinhisgtfmefdayaqpgnsgspvlnskheligilyagsgkdesek nfgvyftpqlkefiqnniek
Timeline for d4mvnd_: