SCOPe 2.04: Domain d4lcpb_: 4lcp B:

Lineage for d4lcpb_ (4lcp B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Putative deaminase NE0047 [142833] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [142834] (9 PDB entries)
   Uniprot Q82Y41 1-189

8. Domain d4lcpb_: 4lcp B: [236186]
   automated match to d2g84b_
   complexed with 6ap, zn

Details for d4lcpb_

PDB Entry: 4lcp, 2 Å

PDB Description: crytsal structure of ne0047 in complex with 2,6-diaminopurine

PDB Compounds: (B:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4lcpb_:

Sequence; same for both SEQRES and ATOM records:

>d4lcpb_ c.97.1.2 (B:) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
ghmndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsg
lliaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfga
viwsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreyn
ac

Timeline for d4lcpb_:

• d4lcpb_ first appeared in SCOPe 2.03
  
• d4lcpb_ appears in SCOPe 2.05
  
• d4lcpb_ appears in the current release, SCOPe 2.08, called d4lcpb1