SCOPe 2.04: Domain d4nzpa1: 4nzp A:4-168

Lineage for d4nzpa1 (4nzp A:4-168)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (16 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [236078] (1 PDB entry)

8. Domain d4nzpa1: 4nzp A:4-168 [236079]
   Other proteins in same PDB: d4nzpa2
   automated match to d1vl2a1

Details for d4nzpa1

PDB Entry: 4nzp, 2.31 Å

PDB Description: The crystal structure of argininosuccinate synthase from Campylobacter jejuni subsp. jejuni NCTC 11168

PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d4nzpa1:

Sequence; same for both SEQRES and ATOM records:

>d4nzpa1 c.26.2.0 (A:4-168) automated matches {Campylobacter jejuni [TaxId: 192222]}
evkkvvlaysggldtsiilkwlqdeyncevvtftadigqgeeleparkkalslgikeeni
fikdlrdefvkdyvfpmfranaiyegeyllgtsiarpliaktqaqialqtgadavshgat
gkgndqvrfelgylafspdlkiiapwrewdlnsrekllayaqkhg

Timeline for d4nzpa1:

• d4nzpa1 first appeared in SCOPe 2.03
  
• d4nzpa1 appears in SCOPe 2.05
  
• d4nzpa1 appears in the current release, SCOPe 2.08