Lineage for d3znta_ (3znt A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1691199Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1691200Protein automated matches [190857] (19 species)
    not a true protein
  7. 1691201Species Acinetobacter baumannii [TaxId:470] [194613] (22 PDB entries)
  8. 1691218Domain d3znta_: 3znt A: [235920]
    automated match to d4f94a_
    complexed with so4, tbe

Details for d3znta_

PDB Entry: 3znt (more details), 1.95 Å

PDB Description: Crystal structure of OXA-24 class D beta-lactamase with tazobactam
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3znta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znta_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
fhissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnali
glenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevk
rvnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikev
ngskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneityksle
nlgii

SCOPe Domain Coordinates for d3znta_:

Click to download the PDB-style file with coordinates for d3znta_.
(The format of our PDB-style files is described here.)

Timeline for d3znta_: