Lineage for d4hkwa1 (4hkw A:2-190)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389908Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)
  8. 2389922Domain d4hkwa1: 4hkw A:2-190 [235866]
    Other proteins in same PDB: d4hkwa2
    automated match to d1enxa_
    complexed with ca, trs; mutant

Details for d4hkwa1

PDB Entry: 4hkw (more details), 1.65 Å

PDB Description: crystal structures of mutant endo-beta-1,4-xylanase ii complexed with substrate and products
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4hkwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hkwa1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

SCOPe Domain Coordinates for d4hkwa1:

Click to download the PDB-style file with coordinates for d4hkwa1.
(The format of our PDB-style files is described here.)

Timeline for d4hkwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hkwa2