Lineage for d4mj0a_ (4mj0 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2432198Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2432636Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2432637Protein automated matches [226836] (7 species)
    not a true protein
  7. 2432638Species Bk polyomavirus [TaxId:10629] [228808] (2 PDB entries)
  8. 2432639Domain d4mj0a_: 4mj0 A: [235643]
    automated match to d4mj0b_
    complexed with bgc, cl, gal, gol, sia

Details for d4mj0a_

PDB Entry: 4mj0 (more details), 1.7 Å

PDB Description: bk polyomavirus vp1 pentamer in complex with gd3 oligosaccharide
PDB Compounds: (A:) VP1 capsid protein

SCOPe Domain Sequences for d4mj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mj0a_ b.121.6.0 (A:) automated matches {Bk polyomavirus [TaxId: 10629]}
vevlevktgvdaitevecflnpemgdpdenlrgfslklsaendfssdsperkmlpcysta
riplpnlnedltcgnllmweavtvqtevigitsmlnlhagsqkvhehgggkpiqgsnfhf
favggdplemqgvlmnyrtkypdgtitpknptaqsqvmntdhkayldknnaypvecwvpd
psrnentryfgtftggenvppvlhvtntattvlldeqgvgplckadslyvsaadicglft
nssgtqqwrglaryfkirlrkrsvk

SCOPe Domain Coordinates for d4mj0a_:

Click to download the PDB-style file with coordinates for d4mj0a_.
(The format of our PDB-style files is described here.)

Timeline for d4mj0a_: