SCOPe 2.04: Domain d4mf5a1: 4mf5 A:-3-103

Lineage for d4mf5a1 (4mf5 A:-3-103)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Burkholderia graminis [TaxId:396598] [227806] (2 PDB entries)

8. Domain d4mf5a1: 4mf5 A:-3-103 [235609]
   Other proteins in same PDB: d4mf5a2
   automated match to d4mf6a1
   complexed with fmt, gsh

Details for d4mf5a1

PDB Entry: 4mf5, 1.11 Å

PDB Description: Crystal structure of glutathione transferase BgramDRAFT_1843 from Burkholderia graminis, Target EFI-507289, with traces of one GSH bound

PDB Compounds: (A:) Glutathione S-transferase domain

SCOPe Domain Sequences for d4mf5a1:

Sequence; same for both SEQRES and ATOM records:

>d4mf5a1 c.47.1.0 (A:-3-103) automated matches {Burkholderia graminis [TaxId: 396598]}
yfqsmtdlsafpitkkwpaahperlqlyslptpngvkvsimleetglpyephlvrfdtnd
qltpefmslnpnnkipaiidpngpdgkplplfesgailiyladktgq

Timeline for d4mf5a1:

• d4mf5a1 first appeared in SCOPe 2.03
  
• d4mf5a1 appears in SCOPe 2.05
  
• d4mf5a1 appears in the current release, SCOPe 2.08