Lineage for d4m9ba_ (4m9b A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431528Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1431529Protein automated matches [190218] (13 species)
    not a true protein
  7. 1431530Species Arachis hypogaea [TaxId:3818] [229316] (4 PDB entries)
  8. 1431531Domain d4m9ba_: 4m9b A: [235550]
    automated match to d4m9wa_
    complexed with na

Details for d4m9ba_

PDB Entry: 4m9b (more details), 1.6 Å

PDB Description: Crystal structure of Apo Ara h 8
PDB Compounds: (A:) Ara h 8 allergen

SCOPe Domain Sequences for d4m9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m9ba_ d.129.3.0 (A:) automated matches {Arachis hypogaea [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

SCOPe Domain Coordinates for d4m9ba_:

Click to download the PDB-style file with coordinates for d4m9ba_.
(The format of our PDB-style files is described here.)

Timeline for d4m9ba_: