PDB entry 4m9b

View 4m9b on RCSB PDB site
Description: Crystal structure of Apo Ara h 8
Class: plant protein
Keywords: Bet v 1 like, Small molecule carrier, PLANT PROTEIN
Deposited on 2013-08-14, released 2013-11-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m9ba_
  • Chain 'B':
    Compound: Ara h 8 allergen
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4m9bb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4m9bA (A:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9bA (A:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4m9bB (B:)
    mgvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltived
    getkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyh
    tkgdakpdeeelkkgkakgeglfraiegyvlanptqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4m9bB (B:)
    gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
    etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
    kgdakpdeeelkkgkakgeglfraiegyvlanptqy