SCOP 1.59: Domain d1rhi2_: 1rhi 2:

Lineage for d1rhi2_ (1rhi 2:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.4: Animal virus proteins [49656] (16 proteins)

6. Protein Rhinovirus coat protein [49670] (5 species)

7. Species Human rhinovirus 3 [49675] (1 PDB entry)

8. Domain d1rhi2_: 1rhi 2: [23553]

Details for d1rhi2_

PDB Entry: 1rhi, 3 Å

PDB Description: human rhinovirus 3 coat protein

SCOP Domain Sequences for d1rhi2_:

Sequence; same for both SEQRES and ATOM records:

>d1rhi2_ b.10.1.4 (2:) Rhinovirus coat protein {Human rhinovirus 3}
gysdrvqqitlgnstittqearnaivcyaewpeylsdndasdvnktskpdisvcrfytld
sktwkatskgwcwklpdalkdmgvfgqnmfyhslgrtgytihvqcnatkfhsgcllvvvi
pehqlasheggtvsvkykythpgdrgidldtvevaggptsdaiynmdgtllgnllifphq
finmrtnntativvpyinsvpidsmtrhnnvslmvvpiaplnaptgssptlpvtvtiapm
cteftgirsrsivpq

Timeline for d1rhi2_:

• d1rhi2_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhi2_ appears in SCOP 1.57
  
• d1rhi2_ appears in SCOP 1.61
  
• d1rhi2_ last appears in SCOP 1.63