Lineage for d4m17h_ (4m17 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607761Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries)
  8. 2607776Domain d4m17h_: 4m17 H: [235521]
    automated match to d4m17a_
    complexed with ca; mutant

Details for d4m17h_

PDB Entry: 4m17 (more details), 2.1 Å

PDB Description: Crystal Structure of Surfactant Protein-D D325A/R343V mutant
PDB Compounds: (H:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d4m17h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m17h_ d.169.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqgqvqhlqaafsqykkvelfpngqsvgekifktagfvkpfteaqllctqaggqlasprs
aaenaalqqlvvakneaaflsmtdsktegkftyptgeslvysnwapgepndaggsedcve
iftngkwndvacgekrlvvcef

SCOPe Domain Coordinates for d4m17h_:

Click to download the PDB-style file with coordinates for d4m17h_.
(The format of our PDB-style files is described here.)

Timeline for d4m17h_: